Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1903753..1904584 Replicon chromosome
Accession NZ_CP124490
Organism Escherichia coli strain AVS0456

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP91_RS08990 Protein ID WP_000854815.1
Coordinates 1903753..1904127 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP91_RS08995 Protein ID WP_001280918.1
Coordinates 1904216..1904584 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP91_RS08950 (1899149) 1899149..1900315 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QJP91_RS08955 (1900434) 1900434..1900907 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP91_RS08960 (1901105) 1901105..1902163 + 1059 WP_001200889.1 FUSC family protein -
QJP91_RS08965 (1902335) 1902335..1902664 + 330 WP_000450409.1 DUF496 family protein -
QJP91_RS08970 (1902765) 1902765..1903088 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP91_RS08975 (1903067) 1903067..1903147 + 81 WP_023441679.1 hypothetical protein -
QJP91_RS08980 (1903436) 1903436..1903516 - 81 Protein_1763 hypothetical protein -
QJP91_RS08985 (1903562) 1903562..1903756 - 195 WP_000988600.1 DUF5983 family protein -
QJP91_RS08990 (1903753) 1903753..1904127 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP91_RS08995 (1904216) 1904216..1904584 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP91_RS09000 (1904600) 1904600..1905244 - 645 WP_000086752.1 hypothetical protein -
QJP91_RS09005 (1905263) 1905263..1905484 - 222 WP_000692345.1 DUF987 domain-containing protein -
QJP91_RS09010 (1905547) 1905547..1906023 - 477 WP_001186200.1 RadC family protein -
QJP91_RS09015 (1906039) 1906039..1906512 - 474 WP_001542276.1 antirestriction protein -
QJP91_RS09020 (1906854) 1906854..1907672 - 819 WP_001542275.1 DUF932 domain-containing protein -
QJP91_RS09025 (1907893) 1907893..1908303 - 411 WP_000846703.1 hypothetical protein -
QJP91_RS09030 (1908319) 1908319..1908669 - 351 Protein_1773 hypothetical protein -
QJP91_RS09035 (1908752) 1908752..1909498 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280543 WP_000854815.1 NZ_CP124490:c1904127-1903753 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280543 WP_001280918.1 NZ_CP124490:c1904584-1904216 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References