Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 60451..61052 | Replicon | plasmid pAVS0542-A |
Accession | NZ_CP124488 | ||
Organism | Escherichia coli strain AVS0542 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | QJP68_RS24575 | Protein ID | WP_001216034.1 |
Coordinates | 60672..61052 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QJP68_RS24570 | Protein ID | WP_001190712.1 |
Coordinates | 60451..60672 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP68_RS24560 (57444) | 57444..58715 | - | 1272 | WP_023142242.1 | restriction endonuclease subunit S | - |
QJP68_RS24565 (58712) | 58712..60268 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
QJP68_RS24570 (60451) | 60451..60672 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QJP68_RS24575 (60672) | 60672..61052 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QJP68_RS24580 (61057) | 61057..61236 | + | 180 | WP_001513661.1 | hypothetical protein | - |
QJP68_RS24585 (61264) | 61264..61542 | + | 279 | Protein_67 | pdcB | - |
QJP68_RS24590 (61547) | 61547..61960 | + | 414 | Protein_68 | integrase core domain-containing protein | - |
QJP68_RS24595 (61910) | 61910..62245 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
QJP68_RS24600 (62455) | 62455..63435 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
QJP68_RS24605 (63679) | 63679..65082 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
QJP68_RS24610 (65069) | 65069..66001 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-27 | - | 1..69343 | 69343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T280535 WP_001216034.1 NZ_CP124488:60672-61052 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |