Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4227961..4228795 | Replicon | chromosome |
| Accession | NZ_CP124487 | ||
| Organism | Escherichia coli strain AVS0542 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP68_RS20770 | Protein ID | WP_000854770.1 |
| Coordinates | 4227961..4228338 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP68_RS20775 | Protein ID | WP_001280950.1 |
| Coordinates | 4228427..4228795 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP68_RS20745 (4224072) | 4224072..4225694 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP68_RS20750 (4226356) | 4226356..4226661 | - | 306 | Protein_4074 | helix-turn-helix domain-containing protein | - |
| QJP68_RS20755 (4227028) | 4227028..4227177 | - | 150 | Protein_4075 | hypothetical protein | - |
| QJP68_RS20760 (4227283) | 4227283..4227459 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP68_RS20765 (4227476) | 4227476..4227964 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP68_RS20770 (4227961) | 4227961..4228338 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP68_RS20775 (4228427) | 4228427..4228795 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP68_RS20780 (4228958) | 4228958..4229179 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP68_RS20785 (4229242) | 4229242..4229718 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP68_RS20790 (4229734) | 4229734..4230198 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP68_RS20795 (4230540) | 4230540..4231358 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP68_RS20800 (4231476) | 4231476..4231671 | - | 196 | Protein_4084 | DUF905 family protein | - |
| QJP68_RS20805 (4231742) | 4231742..4233643 | - | 1902 | Protein_4085 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4216315..4256524 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280529 WP_000854770.1 NZ_CP124487:c4228338-4227961 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280529 WP_001280950.1 NZ_CP124487:c4228795-4228427 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |