Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1961387..1962218 Replicon chromosome
Accession NZ_CP124487
Organism Escherichia coli strain AVS0542

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP68_RS09280 Protein ID WP_000854814.1
Coordinates 1961387..1961761 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP68_RS09285 Protein ID WP_001546021.1
Coordinates 1961850..1962218 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP68_RS09245 (1957382) 1957382..1957711 + 330 WP_000450409.1 DUF496 family protein -
QJP68_RS09250 (1957812) 1957812..1958135 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP68_RS09255 (1958114) 1958114..1958194 + 81 WP_023441679.1 hypothetical protein -
QJP68_RS09260 (1958405) 1958405..1959946 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP68_RS09265 (1959961) 1959961..1960707 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP68_RS09270 (1961070) 1961070..1961150 - 81 Protein_1820 hypothetical protein -
QJP68_RS09275 (1961196) 1961196..1961390 - 195 WP_000988601.1 DUF5983 family protein -
QJP68_RS09280 (1961387) 1961387..1961761 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP68_RS09285 (1961850) 1961850..1962218 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP68_RS09290 (1962298) 1962298..1962519 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP68_RS09295 (1962582) 1962582..1963058 - 477 WP_001186773.1 RadC family protein -
QJP68_RS09300 (1963074) 1963074..1963547 - 474 WP_001385393.1 antirestriction protein -
QJP68_RS09305 (1963810) 1963810..1964631 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP68_RS09310 (1964852) 1964852..1965262 - 411 WP_000846704.1 hypothetical protein -
QJP68_RS09315 (1965278) 1965278..1965955 - 678 WP_001362823.1 hypothetical protein -
QJP68_RS09320 (1966091) 1966091..1967161 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280517 WP_000854814.1 NZ_CP124487:c1961761-1961387 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280517 WP_001546021.1 NZ_CP124487:c1962218-1961850 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References