Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3978310..3978860 Replicon chromosome
Accession NZ_CP124483
Organism Escherichia coli strain AVS0575

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP96_RS19340 Protein ID WP_001160966.1
Coordinates 3978310..3978624 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP96_RS19345 Protein ID WP_000125566.1
Coordinates 3978627..3978860 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP96_RS19315 (3973985) 3973985..3975271 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP96_RS19320 (3975271) 3975271..3976260 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP96_RS19325 (3976257) 3976257..3977078 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP96_RS19330 (3977081) 3977081..3977458 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP96_RS19335 (3977465) 3977465..3978313 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP96_RS19340 (3978310) 3978310..3978624 - 315 WP_001160966.1 CcdB family protein Toxin
QJP96_RS19345 (3978627) 3978627..3978860 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP96_RS19350 (3978946) 3978946..3979425 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP96_RS19355 (3979617) 3979617..3981479 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP96_RS19360 (3981472) 3981472..3982002 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP96_RS19365 (3982110) 3982110..3983441 - 1332 WP_001183207.1 MFS transporter -
QJP96_RS19370 (3983500) 3983500..3983787 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280505 WP_001160966.1 NZ_CP124483:c3978624-3978310 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280505 WP_000125566.1 NZ_CP124483:c3978860-3978627 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References