Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 89174..89699 | Replicon | plasmid pAVS0756-A |
| Accession | NZ_CP124482 | ||
| Organism | Escherichia coli strain AVS0756 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJP55_RS24060 | Protein ID | WP_001159868.1 |
| Coordinates | 89174..89479 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJP55_RS24065 | Protein ID | WP_000813634.1 |
| Coordinates | 89481..89699 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP55_RS24045 (85084) | 85084..86250 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QJP55_RS24050 (86838) | 86838..87593 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP55_RS24055 (88367) | 88367..89173 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QJP55_RS24060 (89174) | 89174..89479 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJP55_RS24065 (89481) | 89481..89699 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJP55_RS24070 (90407) | 90407..91402 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| QJP55_RS24075 (91445) | 91445..92338 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..108535 | 108535 | |
| - | flank | IS/Tn | - | - | 92475..92978 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280486 WP_001159868.1 NZ_CP124482:c89479-89174 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|