Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3066173..3067004 Replicon chromosome
Accession NZ_CP124481
Organism Escherichia coli strain AVS0756

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP55_RS15115 Protein ID WP_000854814.1
Coordinates 3066630..3067004 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP55_RS15110 Protein ID WP_001546021.1
Coordinates 3066173..3066541 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP55_RS15075 (3061230) 3061230..3062300 + 1071 WP_000102631.1 patatin-like phospholipase family protein -
QJP55_RS15080 (3062436) 3062436..3063113 + 678 WP_001362823.1 hypothetical protein -
QJP55_RS15085 (3063129) 3063129..3063539 + 411 WP_000846704.1 hypothetical protein -
QJP55_RS15090 (3063760) 3063760..3064581 + 822 WP_001234710.1 DUF932 domain-containing protein -
QJP55_RS15095 (3064844) 3064844..3065317 + 474 WP_001385393.1 antirestriction protein -
QJP55_RS15100 (3065333) 3065333..3065809 + 477 WP_001186773.1 RadC family protein -
QJP55_RS15105 (3065872) 3065872..3066093 + 222 WP_000692323.1 DUF987 domain-containing protein -
QJP55_RS15110 (3066173) 3066173..3066541 + 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP55_RS15115 (3066630) 3066630..3067004 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP55_RS15120 (3067001) 3067001..3067195 + 195 WP_000988601.1 DUF5983 family protein -
QJP55_RS15125 (3067241) 3067241..3067321 + 81 Protein_2965 hypothetical protein -
QJP55_RS15130 (3067684) 3067684..3068430 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP55_RS15135 (3068445) 3068445..3069986 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP55_RS15140 (3070197) 3070197..3070277 - 81 WP_023441679.1 hypothetical protein -
QJP55_RS15145 (3070256) 3070256..3070579 + 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP55_RS15150 (3070680) 3070680..3071009 - 330 WP_000450409.1 DUF496 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280475 WP_000854814.1 NZ_CP124481:3066630-3067004 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280475 WP_001546021.1 NZ_CP124481:3066173-3066541 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References