Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 889111..889945 | Replicon | chromosome |
| Accession | NZ_CP124481 | ||
| Organism | Escherichia coli strain AVS0756 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP55_RS04245 | Protein ID | WP_000854770.1 |
| Coordinates | 889568..889945 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP55_RS04240 | Protein ID | WP_001280950.1 |
| Coordinates | 889111..889479 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP55_RS04210 (884263) | 884263..886164 | + | 1902 | Protein_821 | Ag43/Cah family autotransporter adhesin | - |
| QJP55_RS04215 (886235) | 886235..886430 | + | 196 | Protein_822 | DUF905 family protein | - |
| QJP55_RS04220 (886548) | 886548..887366 | + | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP55_RS04225 (887708) | 887708..888172 | + | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP55_RS04230 (888188) | 888188..888664 | + | 477 | WP_001186779.1 | RadC family protein | - |
| QJP55_RS04235 (888727) | 888727..888948 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP55_RS04240 (889111) | 889111..889479 | + | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP55_RS04245 (889568) | 889568..889945 | + | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP55_RS04250 (889942) | 889942..890430 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP55_RS04255 (890447) | 890447..890623 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP55_RS04260 (890729) | 890729..890878 | + | 150 | Protein_831 | hypothetical protein | - |
| QJP55_RS04265 (891245) | 891245..891550 | + | 306 | Protein_832 | helix-turn-helix domain-containing protein | - |
| QJP55_RS04270 (892212) | 892212..893834 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 841273..901591 | 60318 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280459 WP_000854770.1 NZ_CP124481:889568-889945 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |