Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 121477..122078 Replicon plasmid pAVS0969-A
Accession NZ_CP124476
Organism Escherichia coli strain AVS0969

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP78_RS26125 Protein ID WP_001216034.1
Coordinates 121698..122078 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP78_RS26120 Protein ID WP_001190712.1
Coordinates 121477..121698 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP78_RS26100 (117349) 117349..118344 + 996 WP_000246636.1 hypothetical protein -
QJP78_RS26105 (118348) 118348..119280 + 933 WP_000991832.1 S-4TM family putative pore-forming effector -
QJP78_RS26115 (120170) 120170..121294 - 1125 Protein_145 type I restriction-modification system subunit M -
QJP78_RS26120 (121477) 121477..121698 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP78_RS26125 (121698) 121698..122078 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP78_RS26130 (122083) 122083..122262 + 180 WP_001513661.1 hypothetical protein -
QJP78_RS26135 (122290) 122290..122568 + 279 Protein_149 pdcB -
QJP78_RS26140 (122573) 122573..122986 + 414 Protein_150 integrase core domain-containing protein -
QJP78_RS26145 (122936) 122936..123271 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP78_RS26150 (123481) 123481..124461 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP78_RS26155 (124705) 124705..126108 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP78_RS26160 (126095) 126095..127027 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-27 senB 1..130369 130369
- inside IScluster/Tn - - 119417..127984 8567


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280450 WP_001216034.1 NZ_CP124476:121698-122078 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280450 WP_001190712.1 NZ_CP124476:121477-121698 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References