Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 121477..122078 | Replicon | plasmid pAVS0969-A |
| Accession | NZ_CP124476 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | QJP78_RS26125 | Protein ID | WP_001216034.1 |
| Coordinates | 121698..122078 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QJP78_RS26120 | Protein ID | WP_001190712.1 |
| Coordinates | 121477..121698 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS26100 (117349) | 117349..118344 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| QJP78_RS26105 (118348) | 118348..119280 | + | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
| QJP78_RS26115 (120170) | 120170..121294 | - | 1125 | Protein_145 | type I restriction-modification system subunit M | - |
| QJP78_RS26120 (121477) | 121477..121698 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QJP78_RS26125 (121698) | 121698..122078 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QJP78_RS26130 (122083) | 122083..122262 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| QJP78_RS26135 (122290) | 122290..122568 | + | 279 | Protein_149 | pdcB | - |
| QJP78_RS26140 (122573) | 122573..122986 | + | 414 | Protein_150 | integrase core domain-containing protein | - |
| QJP78_RS26145 (122936) | 122936..123271 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| QJP78_RS26150 (123481) | 123481..124461 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| QJP78_RS26155 (124705) | 124705..126108 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| QJP78_RS26160 (126095) | 126095..127027 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-27 | senB | 1..130369 | 130369 | |
| - | inside | IScluster/Tn | - | - | 119417..127984 | 8567 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T280450 WP_001216034.1 NZ_CP124476:121698-122078 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |