Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 116116..116641 | Replicon | plasmid pAVS0969-A |
Accession | NZ_CP124476 | ||
Organism | Escherichia coli strain AVS0969 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJP78_RS26090 | Protein ID | WP_001159868.1 |
Coordinates | 116116..116421 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJP78_RS26095 | Protein ID | WP_000813634.1 |
Coordinates | 116423..116641 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP78_RS26075 (112029) | 112029..113193 | - | 1165 | Protein_137 | plasmid-partitioning protein SopA | - |
QJP78_RS26080 (113781) | 113781..114536 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP78_RS26085 (115311) | 115311..116115 | - | 805 | Protein_139 | site-specific integrase | - |
QJP78_RS26090 (116116) | 116116..116421 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP78_RS26095 (116423) | 116423..116641 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP78_RS26100 (117349) | 117349..118344 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QJP78_RS26105 (118348) | 118348..119280 | + | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
QJP78_RS26115 (120170) | 120170..121294 | - | 1125 | Protein_145 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-27 | senB | 1..130369 | 130369 | |
- | inside | IScluster/Tn | - | - | 119417..127984 | 8567 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280449 WP_001159868.1 NZ_CP124476:c116421-116116 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|