Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4520698..4521532 | Replicon | chromosome |
| Accession | NZ_CP124475 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP78_RS22560 | Protein ID | WP_001545731.1 |
| Coordinates | 4521155..4521532 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QJP78_RS22555 | Protein ID | WP_001545732.1 |
| Coordinates | 4520698..4521078 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS22520 (4516984) | 4516984..4517439 | + | 456 | WP_001545736.1 | IrmA family protein | - |
| QJP78_RS22525 (4517518) | 4517518..4517751 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP78_RS22530 (4517851) | 4517851..4518669 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP78_RS22535 (4518724) | 4518724..4519209 | + | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP78_RS22540 (4519225) | 4519225..4519701 | + | 477 | WP_001545734.1 | RadC family protein | - |
| QJP78_RS22545 (4519764) | 4519764..4519985 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| QJP78_RS22550 (4520004) | 4520004..4520648 | + | 645 | WP_001545733.1 | hypothetical protein | - |
| QJP78_RS22555 (4520698) | 4520698..4521078 | + | 381 | WP_001545732.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP78_RS22560 (4521155) | 4521155..4521532 | + | 378 | WP_001545731.1 | TA system toxin CbtA family protein | Toxin |
| QJP78_RS22565 (4521529) | 4521529..4522017 | + | 489 | WP_000761698.1 | DUF5983 family protein | - |
| QJP78_RS22570 (4522034) | 4522034..4522222 | + | 189 | WP_001545730.1 | DUF957 domain-containing protein | - |
| QJP78_RS22575 (4522307) | 4522307..4523154 | + | 848 | Protein_4426 | DUF4942 domain-containing protein | - |
| QJP78_RS22580 (4523213) | 4523213..4523416 | - | 204 | WP_001545728.1 | hypothetical protein | - |
| QJP78_RS22585 (4523426) | 4523426..4524076 | - | 651 | WP_000056749.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| QJP78_RS22590 (4524090) | 4524090..4524554 | - | 465 | WP_000776505.1 | PTS ascorbate transporter subunit IIA | - |
| QJP78_RS22595 (4524564) | 4524564..4524869 | - | 306 | WP_000218362.1 | PTS ascorbate transporter subunit IIB | - |
| QJP78_RS22600 (4524885) | 4524885..4526282 | - | 1398 | WP_000404886.1 | PTS ascorbate transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14054.12 Da Isoelectric Point: 9.1510
>T280444 WP_001545731.1 NZ_CP124475:4521155-4521532 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRAIGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRAIGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13994.73 Da Isoelectric Point: 5.0696
>AT280444 WP_001545732.1 NZ_CP124475:4520698-4521078 [Escherichia coli]
VSDTLSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|