Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4520698..4521532 Replicon chromosome
Accession NZ_CP124475
Organism Escherichia coli strain AVS0969

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QJP78_RS22560 Protein ID WP_001545731.1
Coordinates 4521155..4521532 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QJP78_RS22555 Protein ID WP_001545732.1
Coordinates 4520698..4521078 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP78_RS22520 (4516984) 4516984..4517439 + 456 WP_001545736.1 IrmA family protein -
QJP78_RS22525 (4517518) 4517518..4517751 + 234 WP_001119729.1 DUF905 family protein -
QJP78_RS22530 (4517851) 4517851..4518669 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP78_RS22535 (4518724) 4518724..4519209 + 486 WP_000849588.1 antirestriction protein -
QJP78_RS22540 (4519225) 4519225..4519701 + 477 WP_001545734.1 RadC family protein -
QJP78_RS22545 (4519764) 4519764..4519985 + 222 WP_000692353.1 DUF987 domain-containing protein -
QJP78_RS22550 (4520004) 4520004..4520648 + 645 WP_001545733.1 hypothetical protein -
QJP78_RS22555 (4520698) 4520698..4521078 + 381 WP_001545732.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP78_RS22560 (4521155) 4521155..4521532 + 378 WP_001545731.1 TA system toxin CbtA family protein Toxin
QJP78_RS22565 (4521529) 4521529..4522017 + 489 WP_000761698.1 DUF5983 family protein -
QJP78_RS22570 (4522034) 4522034..4522222 + 189 WP_001545730.1 DUF957 domain-containing protein -
QJP78_RS22575 (4522307) 4522307..4523154 + 848 Protein_4426 DUF4942 domain-containing protein -
QJP78_RS22580 (4523213) 4523213..4523416 - 204 WP_001545728.1 hypothetical protein -
QJP78_RS22585 (4523426) 4523426..4524076 - 651 WP_000056749.1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD -
QJP78_RS22590 (4524090) 4524090..4524554 - 465 WP_000776505.1 PTS ascorbate transporter subunit IIA -
QJP78_RS22595 (4524564) 4524564..4524869 - 306 WP_000218362.1 PTS ascorbate transporter subunit IIB -
QJP78_RS22600 (4524885) 4524885..4526282 - 1398 WP_000404886.1 PTS ascorbate transporter subunit IIC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14054.12 Da        Isoelectric Point: 9.1510

>T280444 WP_001545731.1 NZ_CP124475:4521155-4521532 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRAIGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13994.73 Da        Isoelectric Point: 5.0696

>AT280444 WP_001545732.1 NZ_CP124475:4520698-4521078 [Escherichia coli]
VSDTLSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References