Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4322206..4323040 | Replicon | chromosome |
| Accession | NZ_CP124475 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP78_RS21580 | Protein ID | WP_000854770.1 |
| Coordinates | 4322206..4322583 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP78_RS21585 | Protein ID | WP_001280950.1 |
| Coordinates | 4322672..4323040 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS21555 (4318317) | 4318317..4319939 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP78_RS21560 (4320601) | 4320601..4320906 | - | 306 | Protein_4224 | helix-turn-helix domain-containing protein | - |
| QJP78_RS21565 (4321273) | 4321273..4321422 | - | 150 | Protein_4225 | hypothetical protein | - |
| QJP78_RS21570 (4321528) | 4321528..4321704 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP78_RS21575 (4321721) | 4321721..4322209 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP78_RS21580 (4322206) | 4322206..4322583 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP78_RS21585 (4322672) | 4322672..4323040 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP78_RS21590 (4323203) | 4323203..4323424 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP78_RS21595 (4323487) | 4323487..4323963 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP78_RS21600 (4323979) | 4323979..4324452 | - | 474 | WP_001573543.1 | antirestriction protein | - |
| QJP78_RS21605 (4324794) | 4324794..4325612 | - | 819 | WP_115762908.1 | DUF932 domain-containing protein | - |
| QJP78_RS21610 (4325730) | 4325730..4325925 | - | 196 | Protein_4234 | DUF905 family protein | - |
| QJP78_RS21615 (4325996) | 4325996..4327897 | - | 1902 | Protein_4235 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4310560..4350778 | 40218 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280443 WP_000854770.1 NZ_CP124475:c4322583-4322206 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280443 WP_001280950.1 NZ_CP124475:c4323040-4322672 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |