Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4141646..4142196 Replicon chromosome
Accession NZ_CP124475
Organism Escherichia coli strain AVS0969

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP78_RS20670 Protein ID WP_001160966.1
Coordinates 4141646..4141960 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP78_RS20675 Protein ID WP_000125566.1
Coordinates 4141963..4142196 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP78_RS20645 (4137321) 4137321..4138607 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP78_RS20650 (4138607) 4138607..4139596 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP78_RS20655 (4139593) 4139593..4140414 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP78_RS20660 (4140417) 4140417..4140794 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP78_RS20665 (4140801) 4140801..4141649 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP78_RS20670 (4141646) 4141646..4141960 - 315 WP_001160966.1 CcdB family protein Toxin
QJP78_RS20675 (4141963) 4141963..4142196 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP78_RS20680 (4142282) 4142282..4142761 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP78_RS20685 (4142953) 4142953..4144815 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP78_RS20690 (4144808) 4144808..4145338 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP78_RS20695 (4145446) 4145446..4146777 - 1332 WP_001183207.1 MFS transporter -
QJP78_RS20700 (4146836) 4146836..4147123 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T280441 WP_001160966.1 NZ_CP124475:c4141960-4141646 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280441 WP_000125566.1 NZ_CP124475:c4142196-4141963 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References