Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1960449..1961280 Replicon chromosome
Accession NZ_CP124475
Organism Escherichia coli strain AVS0969

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP78_RS09445 Protein ID WP_000854814.1
Coordinates 1960449..1960823 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP78_RS09450 Protein ID WP_001546021.1
Coordinates 1960912..1961280 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP78_RS09410 (1956444) 1956444..1956773 + 330 WP_000450409.1 DUF496 family protein -
QJP78_RS09415 (1956874) 1956874..1957197 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP78_RS09420 (1957176) 1957176..1957256 + 81 WP_023441679.1 hypothetical protein -
QJP78_RS09425 (1957467) 1957467..1959008 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP78_RS09430 (1959023) 1959023..1959769 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP78_RS09435 (1960132) 1960132..1960212 - 81 Protein_1850 hypothetical protein -
QJP78_RS09440 (1960258) 1960258..1960452 - 195 WP_000988601.1 DUF5983 family protein -
QJP78_RS09445 (1960449) 1960449..1960823 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP78_RS09450 (1960912) 1960912..1961280 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP78_RS09455 (1961360) 1961360..1961581 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP78_RS09460 (1961644) 1961644..1962120 - 477 WP_001186773.1 RadC family protein -
QJP78_RS09465 (1962136) 1962136..1962609 - 474 WP_001385393.1 antirestriction protein -
QJP78_RS09470 (1962873) 1962873..1963694 - 822 WP_213848171.1 DUF932 domain-containing protein -
QJP78_RS09475 (1963915) 1963915..1964325 - 411 WP_000846704.1 hypothetical protein -
QJP78_RS09480 (1964341) 1964341..1965018 - 678 WP_001362823.1 hypothetical protein -
QJP78_RS09485 (1965154) 1965154..1966224 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1905626..1967126 61500


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280432 WP_000854814.1 NZ_CP124475:c1960823-1960449 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280432 WP_001546021.1 NZ_CP124475:c1961280-1960912 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References