Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1960449..1961280 | Replicon | chromosome |
| Accession | NZ_CP124475 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJP78_RS09445 | Protein ID | WP_000854814.1 |
| Coordinates | 1960449..1960823 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJP78_RS09450 | Protein ID | WP_001546021.1 |
| Coordinates | 1960912..1961280 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS09410 (1956444) | 1956444..1956773 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP78_RS09415 (1956874) | 1956874..1957197 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| QJP78_RS09420 (1957176) | 1957176..1957256 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP78_RS09425 (1957467) | 1957467..1959008 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP78_RS09430 (1959023) | 1959023..1959769 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP78_RS09435 (1960132) | 1960132..1960212 | - | 81 | Protein_1850 | hypothetical protein | - |
| QJP78_RS09440 (1960258) | 1960258..1960452 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJP78_RS09445 (1960449) | 1960449..1960823 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP78_RS09450 (1960912) | 1960912..1961280 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP78_RS09455 (1961360) | 1961360..1961581 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP78_RS09460 (1961644) | 1961644..1962120 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QJP78_RS09465 (1962136) | 1962136..1962609 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| QJP78_RS09470 (1962873) | 1962873..1963694 | - | 822 | WP_213848171.1 | DUF932 domain-containing protein | - |
| QJP78_RS09475 (1963915) | 1963915..1964325 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QJP78_RS09480 (1964341) | 1964341..1965018 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| QJP78_RS09485 (1965154) | 1965154..1966224 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1905626..1967126 | 61500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T280432 WP_000854814.1 NZ_CP124475:c1960823-1960449 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT280432 WP_001546021.1 NZ_CP124475:c1961280-1960912 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |