Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 823753..824587 | Replicon | chromosome |
| Accession | NZ_CP124475 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP78_RS04010 | Protein ID | WP_001546109.1 |
| Coordinates | 823753..824130 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | QJP78_RS04015 | Protein ID | WP_001546108.1 |
| Coordinates | 824207..824587 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS03980 (820147) | 820147..820317 | - | 171 | Protein_782 | IS110 family transposase | - |
| QJP78_RS03985 (820734) | 820734..821668 | - | 935 | Protein_783 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP78_RS03990 (821661) | 821661..822056 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP78_RS03995 (822125) | 822125..822970 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJP78_RS04000 (823055) | 823055..823252 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJP78_RS04005 (823269) | 823269..823756 | - | 488 | Protein_787 | DUF5983 family protein | - |
| QJP78_RS04010 (823753) | 823753..824130 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP78_RS04015 (824207) | 824207..824587 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP78_RS04020 (824637) | 824637..825281 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP78_RS04025 (825300) | 825300..825521 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP78_RS04030 (825590) | 825590..826066 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJP78_RS04035 (826082) | 826082..826567 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP78_RS04040 (826622) | 826622..827440 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP78_RS04045 (827540) | 827540..827773 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP78_RS04050 (827852) | 827852..828307 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T280429 WP_001546109.1 NZ_CP124475:c824130-823753 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT280429 WP_001546108.1 NZ_CP124475:c824587-824207 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|