Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 61847..62448 Replicon plasmid pAVS0973-B
Accession NZ_CP124473
Organism Escherichia coli strain AVS0973

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QJP95_RS25310 Protein ID WP_001216045.1
Coordinates 61847..62227 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP95_RS25315 Protein ID WP_001190712.1
Coordinates 62227..62448 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP95_RS25285 (QJP95_25285) 57288..58772 - 1485 WP_000124159.1 hypothetical protein -
QJP95_RS25290 (QJP95_25290) 58772..59965 - 1194 WP_033558680.1 hypothetical protein -
QJP95_RS25295 (QJP95_25295) 60051..60503 - 453 WP_001326849.1 late promoter-activating protein -
QJP95_RS25300 (QJP95_25300) 60592..61635 - 1044 WP_001702234.1 DUF968 domain-containing protein -
QJP95_RS25305 (QJP95_25305) 61663..61842 - 180 WP_001702235.1 hypothetical protein -
QJP95_RS25310 (QJP95_25310) 61847..62227 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP95_RS25315 (QJP95_25315) 62227..62448 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP95_RS25320 (QJP95_25320) 62521..62910 - 390 WP_000506724.1 S24 family peptidase -
QJP95_RS25325 (QJP95_25325) 63034..63285 - 252 WP_001283837.1 DNA polymerase III subunit theta -
QJP95_RS25330 (QJP95_25330) 63318..63668 + 351 WP_000551789.1 hypothetical protein -
QJP95_RS25335 (QJP95_25335) 63920..64570 - 651 WP_001702237.1 hypothetical protein -
QJP95_RS25340 (QJP95_25340) 64552..64926 - 375 WP_033558583.1 hypothetical protein -
QJP95_RS25345 (QJP95_25345) 64933..65226 - 294 WP_000269004.1 hypothetical protein -
QJP95_RS25355 (QJP95_25355) 66181..66414 - 234 WP_000516537.1 hypothetical protein -
QJP95_RS25360 (QJP95_25360) 66500..66760 - 261 WP_001379129.1 hypothetical protein -
QJP95_RS25365 (QJP95_25365) 66757..66987 - 231 Protein_74 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..94790 94790
- flank IS/Tn - - 65731..66006 275


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T280420 WP_001216045.1 NZ_CP124473:c62227-61847 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280420 WP_001190712.1 NZ_CP124473:c62448-62227 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References