Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 61847..62448 | Replicon | plasmid pAVS0973-B |
| Accession | NZ_CP124473 | ||
| Organism | Escherichia coli strain AVS0973 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | QJP95_RS25310 | Protein ID | WP_001216045.1 |
| Coordinates | 61847..62227 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QJP95_RS25315 | Protein ID | WP_001190712.1 |
| Coordinates | 62227..62448 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP95_RS25285 (QJP95_25285) | 57288..58772 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| QJP95_RS25290 (QJP95_25290) | 58772..59965 | - | 1194 | WP_033558680.1 | hypothetical protein | - |
| QJP95_RS25295 (QJP95_25295) | 60051..60503 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| QJP95_RS25300 (QJP95_25300) | 60592..61635 | - | 1044 | WP_001702234.1 | DUF968 domain-containing protein | - |
| QJP95_RS25305 (QJP95_25305) | 61663..61842 | - | 180 | WP_001702235.1 | hypothetical protein | - |
| QJP95_RS25310 (QJP95_25310) | 61847..62227 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QJP95_RS25315 (QJP95_25315) | 62227..62448 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QJP95_RS25320 (QJP95_25320) | 62521..62910 | - | 390 | WP_000506724.1 | S24 family peptidase | - |
| QJP95_RS25325 (QJP95_25325) | 63034..63285 | - | 252 | WP_001283837.1 | DNA polymerase III subunit theta | - |
| QJP95_RS25330 (QJP95_25330) | 63318..63668 | + | 351 | WP_000551789.1 | hypothetical protein | - |
| QJP95_RS25335 (QJP95_25335) | 63920..64570 | - | 651 | WP_001702237.1 | hypothetical protein | - |
| QJP95_RS25340 (QJP95_25340) | 64552..64926 | - | 375 | WP_033558583.1 | hypothetical protein | - |
| QJP95_RS25345 (QJP95_25345) | 64933..65226 | - | 294 | WP_000269004.1 | hypothetical protein | - |
| QJP95_RS25355 (QJP95_25355) | 66181..66414 | - | 234 | WP_000516537.1 | hypothetical protein | - |
| QJP95_RS25360 (QJP95_25360) | 66500..66760 | - | 261 | WP_001379129.1 | hypothetical protein | - |
| QJP95_RS25365 (QJP95_25365) | 66757..66987 | - | 231 | Protein_74 | DUF551 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..94790 | 94790 | |
| - | flank | IS/Tn | - | - | 65731..66006 | 275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T280420 WP_001216045.1 NZ_CP124473:c62227-61847 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |