Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4217124..4217958 | Replicon | chromosome |
| Accession | NZ_CP124471 | ||
| Organism | Escherichia coli strain AVS0973 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP95_RS20700 | Protein ID | WP_000854770.1 |
| Coordinates | 4217124..4217501 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP95_RS20705 | Protein ID | WP_001280950.1 |
| Coordinates | 4217590..4217958 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP95_RS20675 (4213235) | 4213235..4214857 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP95_RS20680 (4215519) | 4215519..4215824 | - | 306 | Protein_4058 | helix-turn-helix domain-containing protein | - |
| QJP95_RS20685 (4216191) | 4216191..4216340 | - | 150 | Protein_4059 | hypothetical protein | - |
| QJP95_RS20690 (4216446) | 4216446..4216622 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP95_RS20695 (4216639) | 4216639..4217127 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP95_RS20700 (4217124) | 4217124..4217501 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP95_RS20705 (4217590) | 4217590..4217958 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP95_RS20710 (4218121) | 4218121..4218342 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP95_RS20715 (4218405) | 4218405..4218881 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP95_RS20720 (4218897) | 4218897..4219361 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP95_RS20725 (4219703) | 4219703..4220521 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP95_RS20730 (4220639) | 4220639..4220834 | - | 196 | Protein_4068 | DUF905 family protein | - |
| QJP95_RS20735 (4220905) | 4220905..4222806 | - | 1902 | Protein_4069 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4205478..4245687 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T280418 WP_000854770.1 NZ_CP124471:c4217501-4217124 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT280418 WP_001280950.1 NZ_CP124471:c4217958-4217590 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |