Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3623193..3623811 | Replicon | chromosome |
Accession | NZ_CP124471 | ||
Organism | Escherichia coli strain AVS0973 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJP95_RS17860 | Protein ID | WP_001291435.1 |
Coordinates | 3623593..3623811 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJP95_RS17855 | Protein ID | WP_000344800.1 |
Coordinates | 3623193..3623567 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP95_RS17845 (3618282) | 3618282..3619475 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QJP95_RS17850 (3619498) | 3619498..3622647 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJP95_RS17855 (3623193) | 3623193..3623567 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJP95_RS17860 (3623593) | 3623593..3623811 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJP95_RS17865 (3623984) | 3623984..3624535 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJP95_RS17870 (3624651) | 3624651..3625121 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QJP95_RS17875 (3625285) | 3625285..3626835 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJP95_RS17880 (3626877) | 3626877..3627230 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
QJP95_RS17890 (3627609) | 3627609..3627920 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QJP95_RS17895 (3627951) | 3627951..3628523 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280414 WP_001291435.1 NZ_CP124471:3623593-3623811 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280414 WP_000344800.1 NZ_CP124471:3623193-3623567 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |