Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1896021..1896852 Replicon chromosome
Accession NZ_CP124471
Organism Escherichia coli strain AVS0973

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP95_RS08915 Protein ID WP_000854814.1
Coordinates 1896021..1896395 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP95_RS08920 Protein ID WP_001546021.1
Coordinates 1896484..1896852 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP95_RS08880 (1892016) 1892016..1892345 + 330 WP_000450409.1 DUF496 family protein -
QJP95_RS08885 (1892446) 1892446..1892769 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP95_RS08890 (1892748) 1892748..1892828 + 81 WP_023441679.1 hypothetical protein -
QJP95_RS08895 (1893039) 1893039..1894580 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP95_RS08900 (1894595) 1894595..1895341 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP95_RS08905 (1895704) 1895704..1895784 - 81 Protein_1749 hypothetical protein -
QJP95_RS08910 (1895830) 1895830..1896024 - 195 WP_000988601.1 DUF5983 family protein -
QJP95_RS08915 (1896021) 1896021..1896395 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP95_RS08920 (1896484) 1896484..1896852 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP95_RS08925 (1896932) 1896932..1897153 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP95_RS08930 (1897216) 1897216..1897692 - 477 WP_001186773.1 RadC family protein -
QJP95_RS08935 (1897708) 1897708..1898181 - 474 WP_001385393.1 antirestriction protein -
QJP95_RS08940 (1898444) 1898444..1899265 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP95_RS08945 (1899486) 1899486..1899896 - 411 WP_000846704.1 hypothetical protein -
QJP95_RS08950 (1899912) 1899912..1900589 - 678 WP_001362823.1 hypothetical protein -
QJP95_RS08955 (1900725) 1900725..1901795 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T280407 WP_000854814.1 NZ_CP124471:c1896395-1896021 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT280407 WP_001546021.1 NZ_CP124471:c1896852-1896484 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References