Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1896021..1896852 | Replicon | chromosome |
| Accession | NZ_CP124471 | ||
| Organism | Escherichia coli strain AVS0973 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJP95_RS08915 | Protein ID | WP_000854814.1 |
| Coordinates | 1896021..1896395 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJP95_RS08920 | Protein ID | WP_001546021.1 |
| Coordinates | 1896484..1896852 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP95_RS08880 (1892016) | 1892016..1892345 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP95_RS08885 (1892446) | 1892446..1892769 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| QJP95_RS08890 (1892748) | 1892748..1892828 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP95_RS08895 (1893039) | 1893039..1894580 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP95_RS08900 (1894595) | 1894595..1895341 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP95_RS08905 (1895704) | 1895704..1895784 | - | 81 | Protein_1749 | hypothetical protein | - |
| QJP95_RS08910 (1895830) | 1895830..1896024 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJP95_RS08915 (1896021) | 1896021..1896395 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP95_RS08920 (1896484) | 1896484..1896852 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP95_RS08925 (1896932) | 1896932..1897153 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP95_RS08930 (1897216) | 1897216..1897692 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QJP95_RS08935 (1897708) | 1897708..1898181 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| QJP95_RS08940 (1898444) | 1898444..1899265 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QJP95_RS08945 (1899486) | 1899486..1899896 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QJP95_RS08950 (1899912) | 1899912..1900589 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| QJP95_RS08955 (1900725) | 1900725..1901795 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T280407 WP_000854814.1 NZ_CP124471:c1896395-1896021 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT280407 WP_001546021.1 NZ_CP124471:c1896852-1896484 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |