Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 970232..970886 | Replicon | chromosome |
Accession | NZ_CP124471 | ||
Organism | Escherichia coli strain AVS0973 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | QJP95_RS04770 | Protein ID | WP_000244765.1 |
Coordinates | 970479..970886 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | QJP95_RS04765 | Protein ID | WP_000354050.1 |
Coordinates | 970232..970498 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP95_RS04745 (966320) | 966320..967753 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
QJP95_RS04750 (967798) | 967798..968109 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QJP95_RS04755 (968273) | 968273..968932 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
QJP95_RS04760 (969009) | 969009..969989 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
QJP95_RS04765 (970232) | 970232..970498 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
QJP95_RS04770 (970479) | 970479..970886 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
QJP95_RS04775 (970926) | 970926..971447 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QJP95_RS04780 (971559) | 971559..972455 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QJP95_RS04785 (972480) | 972480..973190 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QJP95_RS04790 (973196) | 973196..974929 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T280405 WP_000244765.1 NZ_CP124471:970479-970886 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |