Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 30654..31452 | Replicon | plasmid pAVS0747-B |
Accession | NZ_CP124469 | ||
Organism | Escherichia coli strain AVS0747 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | QJB08_RS24595 | Protein ID | WP_000072677.1 |
Coordinates | 30931..31452 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | QJB08_RS24590 | Protein ID | WP_001351987.1 |
Coordinates | 30654..30923 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB08_RS24565 (QJB08_24565) | 26080..27420 | - | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
QJB08_RS24570 (QJB08_24570) | 27465..28205 | - | 741 | WP_001717320.1 | hypothetical protein | - |
QJB08_RS24575 (QJB08_24575) | 28488..29255 | + | 768 | WP_021547968.1 | hypothetical protein | - |
QJB08_RS24580 (QJB08_24580) | 29308..29661 | - | 354 | WP_160394000.1 | hypothetical protein | - |
QJB08_RS24585 (QJB08_24585) | 29667..30335 | - | 669 | WP_053902532.1 | division plane positioning ATPase MipZ | - |
QJB08_RS24590 (QJB08_24590) | 30654..30923 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
QJB08_RS24595 (QJB08_24595) | 30931..31452 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
QJB08_RS24600 (QJB08_24600) | 31621..31872 | - | 252 | WP_257188412.1 | hypothetical protein | - |
QJB08_RS24605 (QJB08_24605) | 31874..32566 | - | 693 | WP_000856757.1 | hypothetical protein | - |
QJB08_RS24610 (QJB08_24610) | 32580..32903 | - | 324 | WP_000064175.1 | hypothetical protein | - |
QJB08_RS24615 (QJB08_24615) | 33085..33369 | - | 285 | WP_283187881.1 | hypothetical protein | - |
QJB08_RS24620 (QJB08_24620) | 33412..34452 | - | 1041 | WP_283187882.1 | tail fiber domain-containing protein | - |
QJB08_RS24625 (QJB08_24625) | 34462..34743 | - | 282 | WP_021518236.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..105196 | 105196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T280399 WP_000072677.1 NZ_CP124469:30931-31452 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |