Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4093601..4094436 | Replicon | chromosome |
Accession | NZ_CP124467 | ||
Organism | Escherichia coli strain AVS0747 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A2S4A272 |
Locus tag | QJB08_RS19945 | Protein ID | WP_001094443.1 |
Coordinates | 4093601..4093978 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7LDN9 |
Locus tag | QJB08_RS19950 | Protein ID | WP_001285607.1 |
Coordinates | 4094068..4094436 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB08_RS19925 (4091953) | 4091953..4092124 | - | 172 | Protein_3914 | integrase | - |
QJB08_RS19930 (4092671) | 4092671..4092814 | - | 144 | Protein_3915 | hypothetical protein | - |
QJB08_RS19935 (4092899) | 4092899..4093096 | - | 198 | WP_219014864.1 | hypothetical protein | - |
QJB08_RS19940 (4093116) | 4093116..4093604 | - | 489 | WP_000761685.1 | DUF5983 family protein | - |
QJB08_RS19945 (4093601) | 4093601..4093978 | - | 378 | WP_001094443.1 | TA system toxin CbtA family protein | Toxin |
QJB08_RS19950 (4094068) | 4094068..4094436 | - | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJB08_RS19955 (4094516) | 4094516..4094737 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
QJB08_RS19960 (4094824) | 4094824..4095300 | - | 477 | WP_001186165.1 | RadC family protein | - |
QJB08_RS19965 (4095315) | 4095315..4095800 | - | 486 | WP_000206664.1 | antirestriction protein | - |
QJB08_RS19970 (4095892) | 4095892..4096710 | - | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
QJB08_RS19975 (4096800) | 4096800..4097033 | - | 234 | WP_112023606.1 | DUF905 family protein | - |
QJB08_RS19980 (4097039) | 4097039..4097716 | - | 678 | WP_001097301.1 | hypothetical protein | - |
QJB08_RS19985 (4097864) | 4097864..4098544 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T280395 WP_001094443.1 NZ_CP124467:c4093978-4093601 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT280395 WP_001285607.1 NZ_CP124467:c4094436-4094068 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4A272 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0JLU8 |