Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3907699..3908219 Replicon chromosome
Accession NZ_CP124467
Organism Escherichia coli strain AVS0747

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJB08_RS19110 Protein ID WP_001160964.1
Coordinates 3907699..3907983 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJB08_RS19115 Protein ID WP_000125566.1
Coordinates 3907986..3908219 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB08_RS19085 (3903344) 3903344..3904630 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJB08_RS19090 (3904630) 3904630..3905619 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJB08_RS19095 (3905616) 3905616..3906437 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJB08_RS19100 (3906440) 3906440..3906817 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJB08_RS19105 (3906824) 3906824..3907672 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJB08_RS19110 (3907699) 3907699..3907983 - 285 WP_001160964.1 CcdB family protein Toxin
QJB08_RS19115 (3907986) 3907986..3908219 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJB08_RS19120 (3908305) 3908305..3908784 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJB08_RS19125 (3908976) 3908976..3910838 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJB08_RS19130 (3910831) 3910831..3911361 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJB08_RS19135 (3911469) 3911469..3912800 - 1332 WP_001183209.1 MFS transporter -
QJB08_RS19140 (3912859) 3912859..3913146 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280394 WP_001160964.1 NZ_CP124467:c3907983-3907699 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280394 WP_000125566.1 NZ_CP124467:c3908219-3907986 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References