Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1875632..1876463 Replicon chromosome
Accession NZ_CP124467
Organism Escherichia coli strain AVS0747

Toxin (Protein)


Gene name yeeV Uniprot ID A0A768PNB2
Locus tag QJB08_RS08935 Protein ID WP_061157912.1
Coordinates 1875632..1876006 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A785EPM7
Locus tag QJB08_RS08940 Protein ID WP_001535568.1
Coordinates 1876095..1876463 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB08_RS08895 (1871028) 1871028..1872194 + 1167 WP_061157914.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QJB08_RS08900 (1872313) 1872313..1872786 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
QJB08_RS08905 (1872984) 1872984..1874042 + 1059 WP_001200890.1 FUSC family protein -
QJB08_RS08910 (1874214) 1874214..1874543 + 330 WP_000450409.1 DUF496 family protein -
QJB08_RS08915 (1874644) 1874644..1874778 - 135 WP_241226211.1 EutP/PduV family microcompartment system protein -
QJB08_RS08920 (1874880) 1874880..1875026 + 147 Protein_1751 transposase domain-containing protein -
QJB08_RS08925 (1875315) 1875315..1875395 - 81 Protein_1752 hypothetical protein -
QJB08_RS08930 (1875441) 1875441..1875635 - 195 WP_000988601.1 DUF5983 family protein -
QJB08_RS08935 (1875632) 1875632..1876006 - 375 WP_061157912.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB08_RS08940 (1876095) 1876095..1876463 - 369 WP_001535568.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJB08_RS08945 (1876537) 1876537..1876758 - 222 WP_061157911.1 DUF987 domain-containing protein -
QJB08_RS08950 (1876821) 1876821..1877297 - 477 WP_001186786.1 RadC family protein -
QJB08_RS08955 (1877313) 1877313..1877792 - 480 WP_061157910.1 antirestriction protein -
QJB08_RS08960 (1878055) 1878055..1878876 - 822 WP_001234571.1 DUF932 domain-containing protein -
QJB08_RS08965 (1879097) 1879097..1879270 - 174 Protein_1760 hypothetical protein -
QJB08_RS08970 (1879374) 1879374..1880582 + 1209 WP_001352368.1 IS4-like element ISVsa5 family transposase -
QJB08_RS08975 (1880597) 1880597..1880845 - 249 Protein_1762 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1879374..1880582 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13871.91 Da        Isoelectric Point: 7.8522

>T280386 WP_061157912.1 NZ_CP124467:c1876006-1875632 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNSITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13481.26 Da        Isoelectric Point: 5.0468

>AT280386 WP_001535568.1 NZ_CP124467:c1876463-1876095 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A768PNB2

Antitoxin

Source ID Structure
AlphaFold DB A0A785EPM7

References