Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 913117..913771 | Replicon | chromosome |
Accession | NZ_CP124467 | ||
Organism | Escherichia coli strain AVS0747 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | QJB08_RS04500 | Protein ID | WP_000244765.1 |
Coordinates | 913364..913771 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | QJB08_RS04495 | Protein ID | WP_000354050.1 |
Coordinates | 913117..913383 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB08_RS04475 (909205) | 909205..910638 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
QJB08_RS04480 (910683) | 910683..910994 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QJB08_RS04485 (911158) | 911158..911817 | + | 660 | WP_218287456.1 | hemolysin III family protein | - |
QJB08_RS04490 (911894) | 911894..912874 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
QJB08_RS04495 (913117) | 913117..913383 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
QJB08_RS04500 (913364) | 913364..913771 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
QJB08_RS04505 (913811) | 913811..914332 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QJB08_RS04510 (914444) | 914444..915340 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QJB08_RS04515 (915365) | 915365..916075 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QJB08_RS04520 (916081) | 916081..917814 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T280384 WP_000244765.1 NZ_CP124467:913364-913771 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |