Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 97325..97926 Replicon plasmid pAVS0947-A
Accession NZ_CP124461
Organism Escherichia coli strain AVS0947

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP79_RS25005 Protein ID WP_001216034.1
Coordinates 97546..97926 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP79_RS25000 Protein ID WP_001190712.1
Coordinates 97325..97546 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP79_RS24970 (92721) 92721..94031 + 1311 WP_001262765.1 DUF262 domain-containing protein -
QJP79_RS24975 (94060) 94060..94158 + 99 Protein_107 IS1 family transposase -
QJP79_RS24980 (94308) 94308..95168 - 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
QJP79_RS24985 (95455) 95455..96159 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
QJP79_RS24990 (96209) 96209..96427 - 219 Protein_110 IS4 family transposase -
QJP79_RS25000 (97325) 97325..97546 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP79_RS25005 (97546) 97546..97926 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP79_RS25010 (97931) 97931..98110 + 180 WP_001513661.1 hypothetical protein -
QJP79_RS25015 (98138) 98138..98416 + 279 Protein_115 pdcB -
QJP79_RS25020 (98421) 98421..98834 + 414 Protein_116 integrase core domain-containing protein -
QJP79_RS25025 (98784) 98784..99119 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP79_RS25030 (99329) 99329..100309 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP79_RS25035 (100553) 100553..101956 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP79_RS25040 (101943) 101943..102875 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B senB 1..110076 110076
- inside IScluster/Tn blaTEM-1B - 94308..109848 15540


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280374 WP_001216034.1 NZ_CP124461:97546-97926 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280374 WP_001190712.1 NZ_CP124461:97325-97546 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References