Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 44069..44594 | Replicon | plasmid pAVS0947-A |
Accession | NZ_CP124461 | ||
Organism | Escherichia coli strain AVS0947 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJP79_RS24680 | Protein ID | WP_001159868.1 |
Coordinates | 44289..44594 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJP79_RS24675 | Protein ID | WP_000813634.1 |
Coordinates | 44069..44287 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP79_RS24645 (39479) | 39479..39985 | - | 507 | WP_000949452.1 | protein disulfide oxidoreductase | - |
QJP79_RS24650 (39975) | 39975..40145 | - | 171 | Protein_42 | DsbA family protein | - |
QJP79_RS24655 (40283) | 40283..40396 | - | 114 | Protein_43 | IS6 family transposase | - |
QJP79_RS24660 (40596) | 40596..41293 | + | 698 | WP_151884388.1 | IS1 family transposase | - |
QJP79_RS24665 (41430) | 41430..42323 | - | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
QJP79_RS24670 (42366) | 42366..43361 | - | 996 | WP_000246636.1 | hypothetical protein | - |
QJP79_RS24675 (44069) | 44069..44287 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP79_RS24680 (44289) | 44289..44594 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP79_RS24685 (44595) | 44595..45401 | + | 807 | WP_000016982.1 | site-specific integrase | - |
QJP79_RS24690 (46175) | 46175..46930 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP79_RS24695 (47518) | 47518..48684 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B | senB | 1..110076 | 110076 | |
- | flank | IS/Tn | - | - | 40916..41293 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280366 WP_001159868.1 NZ_CP124461:44289-44594 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|