Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4027102..4027720 | Replicon | chromosome |
| Accession | NZ_CP124460 | ||
| Organism | Escherichia coli strain AVS0947 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP79_RS19505 | Protein ID | WP_001291435.1 |
| Coordinates | 4027102..4027320 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP79_RS19510 | Protein ID | WP_000344800.1 |
| Coordinates | 4027346..4027720 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP79_RS19470 (4022389) | 4022389..4022961 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| QJP79_RS19475 (4022992) | 4022992..4023303 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP79_RS19485 (4023682) | 4023682..4024035 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QJP79_RS19490 (4024077) | 4024077..4025627 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP79_RS19495 (4025791) | 4025791..4026261 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP79_RS19500 (4026377) | 4026377..4026928 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP79_RS19505 (4027102) | 4027102..4027320 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP79_RS19510 (4027346) | 4027346..4027720 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP79_RS19515 (4028266) | 4028266..4031415 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP79_RS19520 (4031438) | 4031438..4032631 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280360 WP_001291435.1 NZ_CP124460:c4027320-4027102 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280360 WP_000344800.1 NZ_CP124460:c4027720-4027346 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |