Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3572827..3573347 Replicon chromosome
Accession NZ_CP124460
Organism Escherichia coli strain AVS0947

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP79_RS17335 Protein ID WP_001160964.1
Coordinates 3573063..3573347 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP79_RS17330 Protein ID WP_000125566.1
Coordinates 3572827..3573060 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP79_RS17305 (3567900) 3567900..3568187 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP79_RS17310 (3568246) 3568246..3569577 + 1332 WP_001183209.1 MFS transporter -
QJP79_RS17315 (3569685) 3569685..3570215 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP79_RS17320 (3570208) 3570208..3572070 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP79_RS17325 (3572262) 3572262..3572741 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP79_RS17330 (3572827) 3572827..3573060 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP79_RS17335 (3573063) 3573063..3573347 + 285 WP_001160964.1 CcdB family protein Toxin
QJP79_RS17340 (3573374) 3573374..3574222 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP79_RS17345 (3574229) 3574229..3574606 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP79_RS17350 (3574609) 3574609..3575430 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP79_RS17355 (3575427) 3575427..3576416 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP79_RS17360 (3576416) 3576416..3577702 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280358 WP_001160964.1 NZ_CP124460:3573063-3573347 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280358 WP_000125566.1 NZ_CP124460:3572827-3573060 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References