Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3322232..3322827 | Replicon | chromosome |
Accession | NZ_CP124460 | ||
Organism | Escherichia coli strain AVS0947 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QJP79_RS16115 | Protein ID | WP_000239579.1 |
Coordinates | 3322477..3322827 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QJP79_RS16110 | Protein ID | WP_001223208.1 |
Coordinates | 3322232..3322483 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP79_RS16100 (3317897) | 3317897..3321676 | + | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
QJP79_RS16105 (3321679) | 3321679..3322020 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QJP79_RS16110 (3322232) | 3322232..3322483 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QJP79_RS16115 (3322477) | 3322477..3322827 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QJP79_RS16120 (3322907) | 3322907..3323437 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QJP79_RS16125 (3323747) | 3323747..3324703 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QJP79_RS16130 (3324843) | 3324843..3326345 | + | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
QJP79_RS16135 (3326359) | 3326359..3327381 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T280356 WP_000239579.1 NZ_CP124460:3322477-3322827 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |