Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 2416389..2417189 | Replicon | chromosome |
Accession | NZ_CP124460 | ||
Organism | Escherichia coli strain AVS0947 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | QJP79_RS11865 | Protein ID | WP_000342452.1 |
Coordinates | 2416389..2416916 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | QJP79_RS11870 | Protein ID | WP_001277107.1 |
Coordinates | 2416923..2417189 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP79_RS11840 (2411465) | 2411465..2412232 | - | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
QJP79_RS11845 (2412229) | 2412229..2413506 | - | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
QJP79_RS11850 (2413503) | 2413503..2414429 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QJP79_RS11855 (2414477) | 2414477..2415586 | - | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QJP79_RS11860 (2416009) | 2416009..2416392 | + | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QJP79_RS11865 (2416389) | 2416389..2416916 | - | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QJP79_RS11870 (2416923) | 2416923..2417189 | - | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QJP79_RS11875 (2417338) | 2417338..2418441 | - | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QJP79_RS11880 (2418712) | 2418712..2419566 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QJP79_RS11885 (2419811) | 2419811..2420869 | - | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
QJP79_RS11890 (2420862) | 2420862..2421530 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T280354 WP_000342452.1 NZ_CP124460:c2416916-2416389 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |