Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1888008..1888842 | Replicon | chromosome |
| Accession | NZ_CP124460 | ||
| Organism | Escherichia coli strain AVS0947 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QJP79_RS09230 | Protein ID | WP_000854690.1 |
| Coordinates | 1888465..1888842 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QJP79_RS09225 | Protein ID | WP_001305076.1 |
| Coordinates | 1888008..1888376 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP79_RS09185 (1883090) | 1883090..1884217 | + | 1128 | Protein_1800 | hypothetical protein | - |
| QJP79_RS09190 (1884293) | 1884293..1884748 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJP79_RS09195 (1884827) | 1884827..1885060 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QJP79_RS09200 (1885161) | 1885161..1885979 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP79_RS09205 (1886034) | 1886034..1886519 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QJP79_RS09210 (1886535) | 1886535..1887011 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJP79_RS09215 (1887074) | 1887074..1887295 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJP79_RS09220 (1887314) | 1887314..1887958 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJP79_RS09225 (1888008) | 1888008..1888376 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP79_RS09230 (1888465) | 1888465..1888842 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QJP79_RS09235 (1888839) | 1888839..1889327 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QJP79_RS09240 (1889344) | 1889344..1889541 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJP79_RS09245 (1889626) | 1889626..1890471 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJP79_RS09250 (1890540) | 1890540..1890935 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJP79_RS09255 (1890928) | 1890928..1891861 | + | 934 | Protein_1814 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP79_RS09260 (1892278) | 1892278..1892448 | + | 171 | Protein_1815 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1892293..1892448 | 155 | |
| - | inside | Prophage | - | kpsF | 1854510..1894242 | 39732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T280351 WP_000854690.1 NZ_CP124460:1888465-1888842 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT280351 WP_001305076.1 NZ_CP124460:1888008-1888376 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|