Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1888008..1888842 Replicon chromosome
Accession NZ_CP124460
Organism Escherichia coli strain AVS0947

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP79_RS09230 Protein ID WP_000854690.1
Coordinates 1888465..1888842 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP79_RS09225 Protein ID WP_001305076.1
Coordinates 1888008..1888376 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP79_RS09185 (1883090) 1883090..1884217 + 1128 Protein_1800 hypothetical protein -
QJP79_RS09190 (1884293) 1884293..1884748 + 456 WP_000581502.1 IrmA family protein -
QJP79_RS09195 (1884827) 1884827..1885060 + 234 WP_000902034.1 DUF905 family protein -
QJP79_RS09200 (1885161) 1885161..1885979 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP79_RS09205 (1886034) 1886034..1886519 + 486 WP_000849565.1 antirestriction protein -
QJP79_RS09210 (1886535) 1886535..1887011 + 477 WP_001186726.1 RadC family protein -
QJP79_RS09215 (1887074) 1887074..1887295 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP79_RS09220 (1887314) 1887314..1887958 + 645 WP_000094916.1 hypothetical protein -
QJP79_RS09225 (1888008) 1888008..1888376 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP79_RS09230 (1888465) 1888465..1888842 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP79_RS09235 (1888839) 1888839..1889327 + 489 WP_000761699.1 DUF5983 family protein -
QJP79_RS09240 (1889344) 1889344..1889541 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP79_RS09245 (1889626) 1889626..1890471 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP79_RS09250 (1890540) 1890540..1890935 + 396 WP_000208384.1 DUF6088 family protein -
QJP79_RS09255 (1890928) 1890928..1891861 + 934 Protein_1814 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP79_RS09260 (1892278) 1892278..1892448 + 171 Protein_1815 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1892293..1892448 155
- inside Prophage - kpsF 1854510..1894242 39732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280351 WP_000854690.1 NZ_CP124460:1888465-1888842 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280351 WP_001305076.1 NZ_CP124460:1888008-1888376 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References