Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 826674..827505 | Replicon | chromosome |
Accession | NZ_CP124460 | ||
Organism | Escherichia coli strain AVS0947 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A066T988 |
Locus tag | QJP79_RS04315 | Protein ID | WP_000854815.1 |
Coordinates | 827131..827505 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
Locus tag | QJP79_RS04310 | Protein ID | WP_001280918.1 |
Coordinates | 826674..827042 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP79_RS04265 (821763) | 821763..822509 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
QJP79_RS04270 (822592) | 822592..822942 | + | 351 | Protein_838 | hypothetical protein | - |
QJP79_RS04275 (822958) | 822958..823368 | + | 411 | WP_000846703.1 | hypothetical protein | - |
QJP79_RS04280 (823589) | 823589..824407 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
QJP79_RS04285 (824407) | 824407..824652 | + | 246 | WP_001164966.1 | hypothetical protein | - |
QJP79_RS04290 (824746) | 824746..825219 | + | 474 | WP_001542276.1 | antirestriction protein | - |
QJP79_RS04295 (825235) | 825235..825711 | + | 477 | WP_001186200.1 | RadC family protein | - |
QJP79_RS04300 (825774) | 825774..825995 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
QJP79_RS04305 (826014) | 826014..826658 | + | 645 | WP_000086752.1 | hypothetical protein | - |
QJP79_RS04310 (826674) | 826674..827042 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP79_RS04315 (827131) | 827131..827505 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QJP79_RS04320 (827502) | 827502..827696 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
QJP79_RS04325 (827742) | 827742..827822 | + | 81 | Protein_849 | hypothetical protein | - |
QJP79_RS04330 (828111) | 828111..828191 | - | 81 | WP_023441679.1 | hypothetical protein | - |
QJP79_RS04335 (828440) | 828440..828865 | + | 426 | WP_000422741.1 | transposase | - |
QJP79_RS04340 (828862) | 828862..829212 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
QJP79_RS04345 (829243) | 829243..830856 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
QJP79_RS04350 (830899) | 830899..831033 | + | 135 | WP_059338447.1 | EutP/PduV family microcompartment system protein | - |
QJP79_RS04355 (831134) | 831134..831463 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T280348 WP_000854815.1 NZ_CP124460:827131-827505 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A066T988 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061Y7A8 |