Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 139510..140111 Replicon plasmid pAVS0193-A
Accession NZ_CP124456
Organism Escherichia coli strain AVS0193

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP76_RS26250 Protein ID WP_001216034.1
Coordinates 139510..139890 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP76_RS26255 Protein ID WP_001190712.1
Coordinates 139890..140111 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP76_RS26215 (135089) 135089..135793 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
QJP76_RS26220 (135834) 135834..136883 - 1050 Protein_164 S-methylmethionine permease -
QJP76_RS26225 (137127) 137127..138107 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP76_RS26230 (138317) 138317..138652 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP76_RS26235 (138602) 138602..139015 - 414 Protein_167 integrase core domain-containing protein -
QJP76_RS26240 (139020) 139020..139298 - 279 Protein_168 pdcB -
QJP76_RS26245 (139326) 139326..139505 - 180 WP_001513661.1 hypothetical protein -
QJP76_RS26250 (139510) 139510..139890 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP76_RS26255 (139890) 139890..140111 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP76_RS26260 (140304) 140304..141000 + 697 WP_001390273.1 IS1-like element IS1A family transposase -
QJP76_RS26265 (141015) 141015..141233 + 219 Protein_173 IS4 family transposase -
QJP76_RS26270 (141283) 141283..141985 - 703 Protein_174 IS6-like element IS26 family transposase -
QJP76_RS26275 (142048) 142048..142188 + 141 Protein_175 hypothetical protein -
QJP76_RS26280 (142175) 142175..143107 + 933 WP_000081352.1 homocysteine S-methyltransferase -
QJP76_RS26285 (143216) 143216..143545 - 330 Protein_177 TOBE domain-containing protein -
QJP76_RS26295 (144406) 144406..144564 + 159 WP_228955855.1 abortive infection family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 senB 1..146449 146449
- inside IScluster/Tn blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 - 115667..143938 28271


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280342 WP_001216034.1 NZ_CP124456:c139890-139510 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280342 WP_001190712.1 NZ_CP124456:c140111-139890 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References