Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 43770..44295 | Replicon | plasmid pAVS0193-A |
| Accession | NZ_CP124456 | ||
| Organism | Escherichia coli strain AVS0193 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJP76_RS25640 | Protein ID | WP_001159868.1 |
| Coordinates | 43990..44295 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJP76_RS25635 | Protein ID | WP_000813634.1 |
| Coordinates | 43770..43988 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP76_RS25605 (39183) | 39183..39689 | - | 507 | WP_000949452.1 | protein disulfide oxidoreductase | - |
| QJP76_RS25610 (39679) | 39679..39849 | - | 171 | Protein_42 | DsbA family protein | - |
| QJP76_RS25615 (39987) | 39987..40099 | - | 113 | Protein_43 | IS6 family transposase | - |
| QJP76_RS25620 (40299) | 40299..40994 | + | 696 | Protein_44 | IS1 family transposase | - |
| QJP76_RS25625 (41131) | 41131..42024 | - | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
| QJP76_RS25630 (42067) | 42067..43062 | - | 996 | WP_000246636.1 | hypothetical protein | - |
| QJP76_RS25635 (43770) | 43770..43988 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJP76_RS25640 (43990) | 43990..44295 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJP76_RS25645 (44296) | 44296..45102 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| QJP76_RS25650 (45876) | 45876..46631 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP76_RS25655 (47219) | 47219..48385 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..146449 | 146449 | |
| - | flank | IS/Tn | - | - | 40618..40974 | 356 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280337 WP_001159868.1 NZ_CP124456:43990-44295 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|