Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 4582680..4583480 | Replicon | chromosome |
| Accession | NZ_CP124455 | ||
| Organism | Escherichia coli strain AVS0193 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4T503 |
| Locus tag | QJP76_RS22610 | Protein ID | WP_000342452.1 |
| Coordinates | 4582680..4583207 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4T504 |
| Locus tag | QJP76_RS22615 | Protein ID | WP_001277107.1 |
| Coordinates | 4583214..4583480 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP76_RS22585 (4577756) | 4577756..4578523 | - | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QJP76_RS22590 (4578520) | 4578520..4579797 | - | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
| QJP76_RS22595 (4579794) | 4579794..4580720 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QJP76_RS22600 (4580768) | 4580768..4581877 | - | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QJP76_RS22605 (4582300) | 4582300..4582683 | + | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| QJP76_RS22610 (4582680) | 4582680..4583207 | - | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| QJP76_RS22615 (4583214) | 4583214..4583480 | - | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| QJP76_RS22620 (4583629) | 4583629..4584732 | - | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| QJP76_RS22625 (4585003) | 4585003..4585857 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| QJP76_RS22630 (4586102) | 4586102..4587160 | - | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
| QJP76_RS22635 (4587153) | 4587153..4587821 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T280334 WP_000342452.1 NZ_CP124455:c4583207-4582680 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061K5K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061YQ57 |