Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4055552..4056386 | Replicon | chromosome |
| Accession | NZ_CP124455 | ||
| Organism | Escherichia coli strain AVS0193 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QJP76_RS19990 | Protein ID | WP_000854690.1 |
| Coordinates | 4056009..4056386 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QJP76_RS19985 | Protein ID | WP_001305076.1 |
| Coordinates | 4055552..4055920 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP76_RS19945 (4050634) | 4050634..4051761 | + | 1128 | Protein_3903 | hypothetical protein | - |
| QJP76_RS19950 (4051837) | 4051837..4052292 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJP76_RS19955 (4052371) | 4052371..4052604 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QJP76_RS19960 (4052705) | 4052705..4053523 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP76_RS19965 (4053578) | 4053578..4054063 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QJP76_RS19970 (4054079) | 4054079..4054555 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJP76_RS19975 (4054618) | 4054618..4054839 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJP76_RS19980 (4054858) | 4054858..4055502 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJP76_RS19985 (4055552) | 4055552..4055920 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP76_RS19990 (4056009) | 4056009..4056386 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QJP76_RS19995 (4056383) | 4056383..4056871 | + | 489 | WP_283184745.1 | DUF5983 family protein | - |
| QJP76_RS20000 (4056888) | 4056888..4057085 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJP76_RS20005 (4057170) | 4057170..4058015 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJP76_RS20010 (4058084) | 4058084..4058479 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJP76_RS20015 (4058472) | 4058472..4059405 | + | 934 | Protein_3917 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP76_RS20020 (4059822) | 4059822..4059992 | + | 171 | Protein_3918 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4059837..4059992 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T280331 WP_000854690.1 NZ_CP124455:4056009-4056386 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT280331 WP_001305076.1 NZ_CP124455:4055552-4055920 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|