Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2976387..2977218 Replicon chromosome
Accession NZ_CP124455
Organism Escherichia coli strain AVS0193

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP76_RS15015 Protein ID WP_000854815.1
Coordinates 2976844..2977218 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP76_RS15010 Protein ID WP_001280918.1
Coordinates 2976387..2976755 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP76_RS14970 (2971473) 2971473..2972219 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP76_RS14975 (2972302) 2972302..2972652 + 351 Protein_2928 hypothetical protein -
QJP76_RS14980 (2972668) 2972668..2973078 + 411 WP_000846703.1 hypothetical protein -
QJP76_RS14985 (2973299) 2973299..2974117 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP76_RS14990 (2974459) 2974459..2974932 + 474 WP_001542276.1 antirestriction protein -
QJP76_RS14995 (2974948) 2974948..2975424 + 477 WP_001186200.1 RadC family protein -
QJP76_RS15000 (2975487) 2975487..2975708 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP76_RS15005 (2975727) 2975727..2976371 + 645 WP_000086752.1 hypothetical protein -
QJP76_RS15010 (2976387) 2976387..2976755 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP76_RS15015 (2976844) 2976844..2977218 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP76_RS15020 (2977215) 2977215..2977409 + 195 WP_000988600.1 DUF5983 family protein -
QJP76_RS15025 (2977455) 2977455..2977535 + 81 Protein_2938 hypothetical protein -
QJP76_RS15030 (2977824) 2977824..2977904 - 81 WP_023441679.1 hypothetical protein -
QJP76_RS15035 (2977883) 2977883..2978206 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP76_RS15040 (2978307) 2978307..2978636 - 330 WP_000450409.1 DUF496 family protein -
QJP76_RS15045 (2978808) 2978808..2979866 - 1059 WP_001200889.1 FUSC family protein -
QJP76_RS15050 (2980064) 2980064..2980537 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP76_RS15055 (2980656) 2980656..2981822 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280328 WP_000854815.1 NZ_CP124455:2976844-2977218 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280328 WP_001280918.1 NZ_CP124455:2976387-2976755 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References