Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 717028..717548 Replicon chromosome
Accession NZ_CP124455
Organism Escherichia coli strain AVS0193

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP76_RS03415 Protein ID WP_001160964.1
Coordinates 717264..717548 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP76_RS03410 Protein ID WP_000125566.1
Coordinates 717028..717261 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP76_RS03385 (712101) 712101..712388 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP76_RS03390 (712447) 712447..713778 + 1332 WP_001183209.1 MFS transporter -
QJP76_RS03395 (713886) 713886..714416 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP76_RS03400 (714409) 714409..716271 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP76_RS03405 (716463) 716463..716942 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP76_RS03410 (717028) 717028..717261 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP76_RS03415 (717264) 717264..717548 + 285 WP_001160964.1 CcdB family protein Toxin
QJP76_RS03420 (717575) 717575..718423 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP76_RS03425 (718430) 718430..718807 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP76_RS03430 (718810) 718810..719631 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP76_RS03435 (719628) 719628..720617 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP76_RS03440 (720617) 720617..721903 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280316 WP_001160964.1 NZ_CP124455:717264-717548 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280316 WP_000125566.1 NZ_CP124455:717028-717261 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References