Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 524668..525503 | Replicon | chromosome |
Accession | NZ_CP124455 | ||
Organism | Escherichia coli strain AVS0193 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | QJP76_RS02485 | Protein ID | WP_000854759.1 |
Coordinates | 525126..525503 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | QJP76_RS02480 | Protein ID | WP_001295723.1 |
Coordinates | 524668..525036 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP76_RS02450 (520687) | 520687..521712 | + | 1026 | Protein_471 | autotransporter domain-containing protein | - |
QJP76_RS02455 (521783) | 521783..521978 | + | 196 | Protein_472 | DUF905 family protein | - |
QJP76_RS02460 (522096) | 522096..522914 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
QJP76_RS02465 (523256) | 523256..523729 | + | 474 | WP_001350782.1 | antirestriction protein | - |
QJP76_RS02470 (523745) | 523745..524221 | + | 477 | WP_001186775.1 | RadC family protein | - |
QJP76_RS02475 (524284) | 524284..524505 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
QJP76_RS02480 (524668) | 524668..525036 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP76_RS02485 (525126) | 525126..525503 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
QJP76_RS02490 (525500) | 525500..525988 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJP76_RS02495 (526005) | 526005..526181 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJP76_RS02500 (526287) | 526287..526436 | + | 150 | Protein_481 | hypothetical protein | - |
QJP76_RS02505 (526803) | 526803..527108 | + | 306 | Protein_482 | helix-turn-helix domain-containing protein | - |
QJP76_RS02510 (527770) | 527770..529392 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280314 WP_000854759.1 NZ_CP124455:525126-525503 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |