Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4213487..4214105 | Replicon | chromosome |
Accession | NZ_CP124442 | ||
Organism | Escherichia coli strain AVS0196 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJP94_RS20690 | Protein ID | WP_001291435.1 |
Coordinates | 4213487..4213705 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJP94_RS20695 | Protein ID | WP_000344800.1 |
Coordinates | 4213731..4214105 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP94_RS20655 (4208774) | 4208774..4209346 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QJP94_RS20660 (4209377) | 4209377..4209688 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJP94_RS20670 (4210067) | 4210067..4210420 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
QJP94_RS20675 (4210462) | 4210462..4212012 | - | 1551 | Protein_4044 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJP94_RS20680 (4212176) | 4212176..4212646 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJP94_RS20685 (4212762) | 4212762..4213313 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJP94_RS20690 (4213487) | 4213487..4213705 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJP94_RS20695 (4213731) | 4213731..4214105 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJP94_RS20700 (4214651) | 4214651..4217800 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJP94_RS20705 (4217823) | 4217823..4219016 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280300 WP_001291435.1 NZ_CP124442:c4213705-4213487 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280300 WP_000344800.1 NZ_CP124442:c4214105-4213731 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |