Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3774633..3775153 Replicon chromosome
Accession NZ_CP124442
Organism Escherichia coli strain AVS0196

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP94_RS18575 Protein ID WP_001160964.1
Coordinates 3774869..3775153 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP94_RS18570 Protein ID WP_000125566.1
Coordinates 3774633..3774866 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP94_RS18545 (3769706) 3769706..3769993 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP94_RS18550 (3770052) 3770052..3771383 + 1332 WP_001183209.1 MFS transporter -
QJP94_RS18555 (3771491) 3771491..3772021 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP94_RS18560 (3772014) 3772014..3773876 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP94_RS18565 (3774068) 3774068..3774547 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP94_RS18570 (3774633) 3774633..3774866 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP94_RS18575 (3774869) 3774869..3775153 + 285 WP_001160964.1 CcdB family protein Toxin
QJP94_RS18580 (3775180) 3775180..3776028 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP94_RS18585 (3776035) 3776035..3776412 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP94_RS18590 (3776415) 3776415..3777236 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP94_RS18595 (3777233) 3777233..3778222 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP94_RS18600 (3778222) 3778222..3779508 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280298 WP_001160964.1 NZ_CP124442:3774869-3775153 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280298 WP_000125566.1 NZ_CP124442:3774633-3774866 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References