Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3582509..3583344 | Replicon | chromosome |
| Accession | NZ_CP124442 | ||
| Organism | Escherichia coli strain AVS0196 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP94_RS17655 | Protein ID | WP_000854759.1 |
| Coordinates | 3582967..3583344 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP94_RS17650 | Protein ID | WP_001295723.1 |
| Coordinates | 3582509..3582877 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP94_RS17625 (3579624) | 3579624..3579819 | + | 196 | Protein_3444 | DUF905 family protein | - |
| QJP94_RS17630 (3579937) | 3579937..3580755 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP94_RS17635 (3581097) | 3581097..3581570 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP94_RS17640 (3581586) | 3581586..3582062 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJP94_RS17645 (3582125) | 3582125..3582346 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP94_RS17650 (3582509) | 3582509..3582877 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP94_RS17655 (3582967) | 3582967..3583344 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP94_RS17660 (3583341) | 3583341..3583829 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP94_RS17665 (3583846) | 3583846..3584022 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP94_RS17670 (3584128) | 3584128..3584277 | + | 150 | Protein_3453 | hypothetical protein | - |
| QJP94_RS17675 (3584644) | 3584644..3584949 | + | 306 | Protein_3454 | helix-turn-helix domain-containing protein | - |
| QJP94_RS17680 (3585611) | 3585611..3587233 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3568814..3596300 | 27486 | |
| - | inside | Genomic island | - | - | 3568814..3591564 | 22750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280296 WP_000854759.1 NZ_CP124442:3582967-3583344 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280296 WP_001295723.1 NZ_CP124442:3582509-3582877 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |