Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1985947..1986781 Replicon chromosome
Accession NZ_CP124442
Organism Escherichia coli strain AVS0196

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP94_RS09915 Protein ID WP_000854690.1
Coordinates 1986404..1986781 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP94_RS09910 Protein ID WP_001305076.1
Coordinates 1985947..1986315 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP94_RS09865 (1980953) 1980953..1981378 - 426 WP_000422741.1 transposase -
QJP94_RS09870 (1981464) 1981464..1982156 + 693 Protein_1938 hypothetical protein -
QJP94_RS09875 (1982232) 1982232..1982687 + 456 WP_000581502.1 IrmA family protein -
QJP94_RS09880 (1982766) 1982766..1982999 + 234 WP_000902034.1 DUF905 family protein -
QJP94_RS09885 (1983100) 1983100..1983918 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP94_RS09890 (1983973) 1983973..1984458 + 486 WP_000849565.1 antirestriction protein -
QJP94_RS09895 (1984474) 1984474..1984950 + 477 WP_001186726.1 RadC family protein -
QJP94_RS09900 (1985013) 1985013..1985234 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP94_RS09905 (1985253) 1985253..1985897 + 645 WP_000094916.1 hypothetical protein -
QJP94_RS09910 (1985947) 1985947..1986315 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP94_RS09915 (1986404) 1986404..1986781 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP94_RS09920 (1986778) 1986778..1987266 + 489 WP_000761699.1 DUF5983 family protein -
QJP94_RS09925 (1987283) 1987283..1987480 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP94_RS09930 (1987565) 1987565..1987651 + 87 Protein_1950 hypothetical protein -
QJP94_RS09935 (1988506) 1988506..1989489 + 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
QJP94_RS09940 (1989561) 1989561..1990709 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280289 WP_000854690.1 NZ_CP124442:1986404-1986781 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280289 WP_001305076.1 NZ_CP124442:1985947-1986315 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References