Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 867671..868502 | Replicon | chromosome |
| Accession | NZ_CP124442 | ||
| Organism | Escherichia coli strain AVS0196 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | QJP94_RS04645 | Protein ID | WP_000854815.1 |
| Coordinates | 868128..868502 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | QJP94_RS04640 | Protein ID | WP_001280918.1 |
| Coordinates | 867671..868039 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP94_RS04595 (862760) | 862760..863506 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP94_RS04600 (863589) | 863589..863939 | + | 351 | Protein_906 | hypothetical protein | - |
| QJP94_RS04605 (863955) | 863955..864365 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| QJP94_RS04610 (864586) | 864586..865404 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| QJP94_RS04615 (865404) | 865404..865649 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QJP94_RS04620 (865743) | 865743..866216 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| QJP94_RS04625 (866232) | 866232..866708 | + | 477 | WP_001186200.1 | RadC family protein | - |
| QJP94_RS04630 (866771) | 866771..866992 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP94_RS04635 (867011) | 867011..867655 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| QJP94_RS04640 (867671) | 867671..868039 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP94_RS04645 (868128) | 868128..868502 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP94_RS04650 (868499) | 868499..868693 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QJP94_RS04655 (868739) | 868739..868819 | + | 81 | Protein_917 | hypothetical protein | - |
| QJP94_RS04660 (869108) | 869108..869188 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP94_RS04665 (869167) | 869167..869490 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
| QJP94_RS04670 (869591) | 869591..869920 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP94_RS04675 (870092) | 870092..871150 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
| QJP94_RS04680 (871348) | 871348..871821 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| QJP94_RS04685 (871940) | 871940..873106 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T280286 WP_000854815.1 NZ_CP124442:868128-868502 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |