Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 44835..45436 Replicon plasmid pAVS0790-A
Accession NZ_CP124437
Organism Escherichia coli strain AVS0790

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP66_RS25720 Protein ID WP_001216034.1
Coordinates 45056..45436 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP66_RS25715 Protein ID WP_001190712.1
Coordinates 44835..45056 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP66_RS25705 (41828) 41828..43099 - 1272 WP_023142242.1 restriction endonuclease subunit S -
QJP66_RS25710 (43096) 43096..44652 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJP66_RS25715 (44835) 44835..45056 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP66_RS25720 (45056) 45056..45436 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP66_RS25725 (45441) 45441..45620 + 180 WP_001513661.1 hypothetical protein -
QJP66_RS25730 (45648) 45648..45926 + 279 Protein_62 pdcB -
QJP66_RS25735 (45931) 45931..46344 + 414 Protein_63 integrase core domain-containing protein -
QJP66_RS25740 (46294) 46294..46629 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP66_RS25745 (46839) 46839..47819 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP66_RS25750 (48063) 48063..49466 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP66_RS25755 (49453) 49453..50385 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..82979 82979


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280279 WP_001216034.1 NZ_CP124437:45056-45436 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280279 WP_001190712.1 NZ_CP124437:44835-45056 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References