Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 35085..35610 | Replicon | plasmid pAVS0790-A |
Accession | NZ_CP124437 | ||
Organism | Escherichia coli strain AVS0790 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJP66_RS25675 | Protein ID | WP_001159868.1 |
Coordinates | 35085..35390 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJP66_RS25680 | Protein ID | WP_000813634.1 |
Coordinates | 35392..35610 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP66_RS25660 (30995) | 30995..32161 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJP66_RS25665 (32749) | 32749..33504 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP66_RS25670 (34278) | 34278..35084 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QJP66_RS25675 (35085) | 35085..35390 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP66_RS25680 (35392) | 35392..35610 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP66_RS25685 (36318) | 36318..37313 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QJP66_RS25690 (37356) | 37356..38249 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..82979 | 82979 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280278 WP_001159868.1 NZ_CP124437:c35390-35085 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|