Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3581219..3582054 | Replicon | chromosome |
| Accession | NZ_CP124436 | ||
| Organism | Escherichia coli strain AVS0790 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP66_RS17640 | Protein ID | WP_000854759.1 |
| Coordinates | 3581677..3582054 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP66_RS17635 | Protein ID | WP_001295723.1 |
| Coordinates | 3581219..3581587 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP66_RS17610 (3578334) | 3578334..3578529 | + | 196 | Protein_3441 | DUF905 family protein | - |
| QJP66_RS17615 (3578647) | 3578647..3579465 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP66_RS17620 (3579807) | 3579807..3580280 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP66_RS17625 (3580296) | 3580296..3580772 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJP66_RS17630 (3580835) | 3580835..3581056 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP66_RS17635 (3581219) | 3581219..3581587 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP66_RS17640 (3581677) | 3581677..3582054 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP66_RS17645 (3582051) | 3582051..3582539 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP66_RS17650 (3582556) | 3582556..3582732 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP66_RS17655 (3582838) | 3582838..3582987 | + | 150 | Protein_3450 | hypothetical protein | - |
| QJP66_RS17660 (3583354) | 3583354..3583659 | + | 306 | Protein_3451 | helix-turn-helix domain-containing protein | - |
| QJP66_RS17665 (3584321) | 3584321..3585943 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3567524..3595010 | 27486 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280265 WP_000854759.1 NZ_CP124436:3581677-3582054 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280265 WP_001295723.1 NZ_CP124436:3581219-3581587 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |