Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1840525..1841179 | Replicon | chromosome |
| Accession | NZ_CP124436 | ||
| Organism | Escherichia coli strain AVS0790 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | QJP66_RS09125 | Protein ID | WP_000244765.1 |
| Coordinates | 1840525..1840932 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | F4T2L5 |
| Locus tag | QJP66_RS09130 | Protein ID | WP_000354050.1 |
| Coordinates | 1840913..1841179 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP66_RS09105 (1836482) | 1836482..1838215 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QJP66_RS09110 (1838221) | 1838221..1838931 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QJP66_RS09115 (1838956) | 1838956..1839852 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QJP66_RS09120 (1839964) | 1839964..1840485 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QJP66_RS09125 (1840525) | 1840525..1840932 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
| QJP66_RS09130 (1840913) | 1840913..1841179 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
| QJP66_RS09135 (1841422) | 1841422..1842402 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
| QJP66_RS09140 (1842479) | 1842479..1843138 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
| QJP66_RS09145 (1843302) | 1843302..1843613 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| QJP66_RS09150 (1843658) | 1843658..1845091 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T280257 WP_000244765.1 NZ_CP124436:c1840932-1840525 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061L3F4 |