Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 867509..868340 Replicon chromosome
Accession NZ_CP124436
Organism Escherichia coli strain AVS0790

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP66_RS04645 Protein ID WP_000854815.1
Coordinates 867966..868340 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP66_RS04640 Protein ID WP_001280918.1
Coordinates 867509..867877 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP66_RS04595 (862598) 862598..863344 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP66_RS04600 (863427) 863427..863777 + 351 Protein_906 hypothetical protein -
QJP66_RS04605 (863793) 863793..864203 + 411 WP_000846703.1 hypothetical protein -
QJP66_RS04610 (864424) 864424..865242 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP66_RS04615 (865242) 865242..865487 + 246 WP_001164966.1 hypothetical protein -
QJP66_RS04620 (865581) 865581..866054 + 474 WP_001542276.1 antirestriction protein -
QJP66_RS04625 (866070) 866070..866546 + 477 WP_001186200.1 RadC family protein -
QJP66_RS04630 (866609) 866609..866830 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP66_RS04635 (866849) 866849..867493 + 645 WP_000086752.1 hypothetical protein -
QJP66_RS04640 (867509) 867509..867877 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP66_RS04645 (867966) 867966..868340 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP66_RS04650 (868337) 868337..868531 + 195 WP_000988600.1 DUF5983 family protein -
QJP66_RS04655 (868577) 868577..868657 + 81 Protein_917 hypothetical protein -
QJP66_RS04660 (868946) 868946..869026 - 81 WP_023441679.1 hypothetical protein -
QJP66_RS04665 (869005) 869005..869328 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP66_RS04670 (869429) 869429..869758 - 330 WP_000450409.1 DUF496 family protein -
QJP66_RS04675 (869930) 869930..870988 - 1059 WP_001200889.1 FUSC family protein -
QJP66_RS04680 (871186) 871186..871659 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP66_RS04685 (871778) 871778..872944 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280255 WP_000854815.1 NZ_CP124436:867966-868340 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280255 WP_001280918.1 NZ_CP124436:867509-867877 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References